SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024408 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024408
Domain Number 1 Region: 1355-1468
Classification Level Classification E-value
Superfamily C-type lectin-like 8.01e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000289
Further Details:      
 
Domain Number 2 Region: 1249-1354
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024408   Gene: ENSNLEG00000014085   Transcript: ENSNLET00000032774
Sequence length 1470
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:4341452:4397405:-1 gene:ENSNLEG00000014085 transcript:ENSNLET00000032774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGFKGEPGPKGFPGISGPPGF
PGLGTTGEKGEKGIPGLPGPRGPMGSEGVHGPPGQQGKKGTLGFPGLNGFQGIEGQKGDI
GLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALG
PQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKEPGFPGLR
GEQGPKGNPGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSG
GAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGIPGDRGDSGSQGFRGVTGEPGKDGVP
GLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGIGLPGLPGPRGLPGDKGKDGL
PGQQGLSGPKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGNKGEPGS
PGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAP
GEQGLQGLTGDKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPY
GIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSP
GSPGVAGLPAPSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTP
GEKGDRGNPGPVGIPSPRSPLSNLWLRGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLP
GPPGLPGITKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGA
SGLPGLKGDNGQTAEISGSPGPKGQPGESGFKGTKGKDGLIGNIGFPGNKGEDGKVGVSG
DVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPG
TKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDQGFPGLQGPAG
LPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSNQGDTGDPGFPGIPG
PKGPKGDQGIPGFSGLPGKLGLKGVRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSG
PQGAPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPS
GLPGPPGAFGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSVRVGYTLVKHSQSEQVPL
CPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDK
SYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGY
SFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQ
QFGELPVSETLKAGQLHSRVSRCQVCMKSL
Download sequence
Identical sequences ENSNLEP00000024408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]