SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024412 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024412
Domain Number 1 Region: 146-266
Classification Level Classification E-value
Superfamily Immunoglobulin 7.5e-16
Family C1 set domains (antibody constant domain-like) 0.0043
Further Details:      
 
Domain Number 2 Region: 61-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000311
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024412   Gene: ENSNLEG00000003709   Transcript: ENSNLET00000032092
Sequence length 338
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:6410804:6426163:1 gene:ENSNLEG00000003709 transcript:ENSNLET00000032092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRETTVETAAWFMANVQVSGGGPSISMVMKTPRDAKNEVLWHPTLNLPLSPQGTVRTAVE
FQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVR
KGATLEPEQLGMARDASLTLPSLTIQDEGTYICQITTSVYRAQQIIQLNIQASPKVRLNL
ANEALLPTLICDIVGYYPLDVVVTWTREELSGSPAQVSGASFSSLRQSVAGTYSISSSLV
AEPGSAGATYTCQVTHISLEEPLRASTQVVPPERRTALGVIFASSLFLLALLFLRLQKRQ
ALQHCSQIVMLLPARHRLGHPALTASGPSPGPCPRSHA
Download sequence
Identical sequences ENSNLEP00000024412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]