SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024415 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024415
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.41e-23
Family MHC antigen-recognition domain 0.00000431
Further Details:      
 
Domain Number 2 Region: 109-194
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-22
Family C1 set domains (antibody constant domain-like) 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024415   Gene: ENSNLEG00000026651   Transcript: ENSNLET00000032780
Sequence length 243
Comment pep:novel supercontig:Nleu1.0:GL397342.1:8276567:8291389:1 gene:ENSNLEG00000026651 transcript:ENSNLET00000032780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAHLKDQKGGLHSLQEITVCEIHEDNSTRAFWHFYYDEELFLSQNLETQEQTEPQSSR
AQILAMNVTNFWKEDAMKTKTHYRAVQADCLQKLQQYRKSGIVLRRTVPPMVIVTRSEAS
EGNITVTCWASGFYPWNITLTWRQDGVSLSHDAQQWGDVLRDENGTYQTWVATRIRQGEE
QRFTCHVEHSGNHGTHPVPSDEPRVTLERESAGAPESMDRHSIFFCCCCCCCYFCYYFLR
PFV
Download sequence
Identical sequences ENSNLEP00000024415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]