SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024434 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000024434
Domain Number - Region: 34-110
Classification Level Classification E-value
Superfamily RING/U-box 0.000365
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number - Region: 9-41
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0275
Family B-box zinc-binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024434   Gene: ENSNLEG00000005476   Transcript: ENSNLET00000032800
Sequence length 310
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:4061648:4067033:1 gene:ENSNLEG00000005476 transcript:ENSNLET00000032800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPL
ASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALRE
KLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFY
SQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPA
LGWLAQLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPL
MNPHIRVGPS
Download sequence
Identical sequences A0A0D9R5I2 A0A2K5KJK4 A0A2K5ZEA8 A0A2K6LLU1 A0A2K6ND94 G1R0B3 G3QJQ6 G7NCG2 G7PPJ7
ENSNLEP00000006634 XP_003274228.1.23891 XP_004051527.2.27298 XP_007988781.1.81039 XP_007988855.1.81039 XP_007988936.1.81039 XP_007988960.1.81039 XP_010362248.1.97406 XP_010362249.1.97406 XP_010362250.1.97406 XP_010362251.1.97406 XP_011848926.1.47321 XP_011848927.1.47321 XP_011897147.1.92194 XP_011897148.1.92194 XP_014969298.1.72884 XP_014969299.1.72884 XP_014969300.1.72884 XP_017749017.1.44346 XP_018891582.1.27298 XP_018891583.1.27298 ENSNLEP00000006634 ENSNLEP00000024434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]