SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024445 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024445
Domain Number 1 Region: 188-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000927
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 148-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000236
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000024445
Domain Number - Region: 311-393
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024445   Gene: ENSNLEG00000026920   Transcript: ENSNLET00000032812
Sequence length 395
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:3435957:3457965:-1 gene:ENSNLEG00000026920 transcript:ENSNLET00000032812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTFTTTILKTSQPLLTTPGTLSSTASLVTGPIAIQTTAGKQLSLTHPEILVPHISTEG
GISTERNQVNVDATTGLIPLTSVPTSAKEMTTKLGVTAEYSPASHSLGTSPSPQTTVVST
AEALAPKSATFAVQSSTRSPTTLSSSASVNSCAVNPCLHGGECITDNTSRGYHCRCPPSW
QGDDCSVDVNECLSNPCPSTATCNNTQGSFICKCPVGYQLEKGICNLVRTFVTEFKLKRT
FLNTTVEKHSDLQEVENEITKTLNMCFSALPSYIRSTVHASRESNAVVISLQTTFSLASN
VTLFDLADRMQKCVNSCKSSAEVCQLLGSQRRIFRAGSLCKRKSPECDKDTSICTDLDGV
ALCQCKSGYFQFNKMDHSCRACEDGYRLENETCMR
Download sequence
Identical sequences ENSNLEP00000024445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]