SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024471 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024471
Domain Number 1 Region: 34-133
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-46
Family Fibronectin type III 0.00000104
Further Details:      
 
Domain Number 2 Region: 133-231
Classification Level Classification E-value
Superfamily Fibronectin type III 5.68e-27
Family Fibronectin type III 0.00000129
Further Details:      
 
Domain Number 3 Region: 230-336
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-24
Family Fibronectin type III 0.000000613
Further Details:      
 
Domain Number 4 Region: 446-620
Classification Level Classification E-value
Superfamily Fibronectin type III 2.34e-19
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 334-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000738
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024471   Gene: ENSNLEG00000002075   Transcript: ENSNLET00000032837
Sequence length 928
Comment pep:known_by_projection supercontig:Nleu1.0:GL397303.1:1103927:1145433:-1 gene:ENSNLEG00000002075 transcript:ENSNLET00000032837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLQKYPCKMLTLQTWLVQALFIFLTTKSMGELLDPCGYISPESPVVQLHSNFTAVCVL
KEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQ
LEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDRGRETHLETNFTLKSEWATHKFA
DCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSV
INSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLK
PFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLV
WKTLPPFEANGKILDYEVTFTRWKSHLQNYTVNATKLTVNLTNDRYVATLTARNLVGKSD
VAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCIADW
QQEDGTVHRTHLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKV
GKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMV
RMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKH
IWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKS
LDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQ
VPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISH
FGRSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAANAFGPGTEGQVERFET
VGMEAAIDEGMPKSYLPQTVRQGGYMPQ
Download sequence
Identical sequences ENSNLEP00000024471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]