SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000099 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000099
Domain Number 1 Region: 139-445
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000329
Further Details:      
 
Domain Number 2 Region: 30-135
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-31
Family SH2 domain 0.000000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000099   Gene: ENSNLEG00000000078   Transcript: ENSNLET00000000108
Sequence length 516
Comment pep:known_by_projection supercontig:Nleu1.0:GL397363.1:833088:909372:1 gene:ENSNLEG00000000078 transcript:ENSNLET00000000108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQ
SHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNP
MVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKL
LYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNS
KPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYG
VMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLD
FLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMV
RSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQ
SPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
Download sequence
Identical sequences ENSNLEP00000000099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]