SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000204 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000204
Domain Number 1 Region: 33-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.22e-99
Family Integrin alpha N-terminal domain 0.0000000000000456
Further Details:      
 
Domain Number 2 Region: 776-1001
Classification Level Classification E-value
Superfamily Integrin domains 2.14e-63
Family Integrin domains 0.00029
Further Details:      
 
Domain Number 3 Region: 483-635
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-35
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 4 Region: 636-770
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-34
Family Integrin domains 0.0000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000204   Gene: ENSNLEG00000000152   Transcript: ENSNLET00000000219
Sequence length 1040
Comment pep:known_by_projection contig::ADFV01136076.1:1102:17014:-1 gene:ENSNLEG00000000152 transcript:ENSNLET00000000219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALCPLQALWLLEWVLRLLGPCAAPPAWALNLDPVQLTFYAGPNGSHFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDIIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYKENNFGLDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRP
GILLWHVPSQSLSFDSSTPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTRSGTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGGGQV
LVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGTHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDTANEGEGAYEAELAVHLPQGAHYMWALSNVEGFERLICNQKKENETTRVVLCE
LGNPMKKNTQIGITMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQV
ELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQ
PADLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPTPSPSPIHRAHHKRDRRQIFLPEPEQ
PSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHA
WFNVSSLPYAVPQLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMW
KVGFFKRNRPPLEEDDKEGE
Download sequence
Identical sequences ENSNLEP00000000204 ENSNLEP00000000204 XP_003282434.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]