SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000445 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000445
Domain Number 1 Region: 122-504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.34e-151
Family Myotubularin-like phosphatases 0.0000000173
Further Details:      
 
Domain Number 2 Region: 7-114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000148
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000445   Gene: ENSNLEG00000000373   Transcript: ENSNLET00000000473
Sequence length 710
Comment pep:known_by_projection supercontig:Nleu1.0:GL397348.1:2555284:2663154:-1 gene:ENSNLEG00000000373 transcript:ENSNLET00000000473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEK
LPITSLGCPLTLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSK
EMRESGWKLIDPISDFGRMGIPNRNWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSS
KFRSKERVPVLSYLYKENNAAICRCSQPLSGFYTRCVDDELLLEAISQTNPGSQFMYVVD
TRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMRSSLQKLLEVCELKTPTMSEF
LSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCSVASILLDPFY
RTFKGLMILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN
ENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTM
YGVLNPSTVPYNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKA
HDEPPEEICTCSQLGNILSQHLGSPLTNPLGFMGIDGDLNTLMENGTLSREGGLRAQMDQ
VKSQCADLHHNCCEIVGSLRAINISGDVGISGGTGISEAMGISGDMSTFEAMGFSEDLGI
YGAMDISEATGISGNLGISEARGFSGDMGILGDTGVSKASTKEADYSKHQ
Download sequence
Identical sequences XP_003272696.1.23891 ENSNLEP00000000445 ENSNLEP00000000445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]