SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000467 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000467
Domain Number 1 Region: 142-290
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-45
Family Dual specificity phosphatase-like 0.00000243
Further Details:      
 
Domain Number 2 Region: 4-121
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000596
Family Cell cycle control phosphatase, catalytic domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000467   Gene: ENSNLEG00000000401   Transcript: ENSNLET00000000497
Sequence length 345
Comment pep:known_by_projection supercontig:Nleu1.0:GL397354.1:4889954:4893265:-1 gene:ENSNLEG00000000401 transcript:ENSNLET00000000497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAQCLLLECRSFFAFAGHLAGSVLVRFFTIVRRRAKGAMGLDHIVPNANLRGRLLASAYH
ELVLLDRSAALNGTKPAGRLGSHAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTP
MGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITA
LINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGI
SRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAG
SPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Download sequence
Identical sequences ENSNLEP00000000467 ENSNLEP00000000467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]