SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000830 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000000830
Domain Number - Region: 157-194,308-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000830   Gene: ENSNLEG00000000702   Transcript: ENSNLET00000000881
Sequence length 495
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:3347220:3376081:-1 gene:ENSNLEG00000000702 transcript:ENSNLET00000000881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAITHLTLLALLFVNTASSQSSSPVVTATETATSGPTVAATDTTETNFPETASTTTNTP
SFPTATSPASPIINTHSSSTIPTPTATDSESTTNANSLATSDIITTSSTNDGLITTVHSE
TQSNNETFPTTKDNQSSGPPTGTTLLESSTLSNTVPSSPCQDDPCADNSLCVELNNTHFC
LCLEGYYYNSSTCKKGKVFPGTILVKVSETFDPEEKHSMAYQDLHREITSFFKDVFGTSV
YGQTVILTVSTPRSPRSEMRADDKVVNVTIVTILTETTSDDEKTVTTKINKATGNNSSNI
LNYNSTSRCDYYGCNQTADDCLDGLACDCKSDLQRPSPQSPFCVASSLKCPEACNAEHKQ
CLIKKNGGAPECACMPGYEEDANQNCQKCAFGYSGLDCKDKFQLILTIVGTIAGIVILSM
IIALIVTARSNNKKKDIEEENLIDEDFQNLKLQPTGFTNLGAEGSIFPKVRIAASRDSQM
QNPYASQSNMPRPDY
Download sequence
Identical sequences G1QIT6
XP_003275598.1.23891 ENSNLEP00000000830 ENSNLEP00000000830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]