SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001313 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001313
Domain Number 1 Region: 266-296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000068
Family CCCH zinc finger 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001313
Domain Number - Region: 189-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00863
Family CCCH zinc finger 0.0061
Further Details:      
 
Domain Number - Region: 242-291,733-780
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 622-664
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0353
Family Outer membrane lipoprotein 0.0087
Further Details:      
 
Domain Number - Region: 97-133
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0732
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001313   Gene: ENSNLEG00000001120   Transcript: ENSNLET00000001390
Sequence length 786
Comment pep:known_by_projection supercontig:Nleu1.0:GL397452.1:959110:988169:1 gene:ENSNLEG00000001120 transcript:ENSNLET00000001390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEEPDASNRLCVRRKISILVFRYLKEFRTEQCPLFVQHKCTQHRPYTCFHWHFVNQRR
RRSIRRRDGTFNYSPDVYCTKCPFLHRTTGDTERRYHLRYYKTGICIHETDSKGNCTKNG
LHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVEGSIEGQSAGAASHAMIEKILSEEP
RWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNVKHGD
EWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPL
SDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCG
SPPGSIRKPPNLEGIVFPGESGLVPGSYKKAPGFEREDQVGAEYLKNFKCQAKLKPHSLE
PRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSSLAATPPSPVGTSSVPGMNANALPF
YPTSDTVESVIESALDDLDLNEFGVAALEKTFDNSTVPHPGSITIGGSLLQSSAPVNIPG
SLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSENTFLGTSASHGSLGLNGMNSSIWEH
FASGSFSPGTSPAFLSGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKEAEE
AGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQTLPAFSDLEALSLSTLY
SLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVLPCQHAALCELCAEGSECPICQPGR
AHALQS
Download sequence
Identical sequences ENSNLEP00000001313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]