SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001480 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001480
Domain Number 1 Region: 70-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-27
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 652-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 735-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 779-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 389-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 698-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000424
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001480
Domain Number - Region: 351-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000294
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 197-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000577
Family Classic zinc finger, C2H2 0.068
Further Details:      
 
Domain Number - Region: 309-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00175
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001480   Gene: ENSNLEG00000001249   Transcript: ENSNLET00000001563
Sequence length 840
Comment pep:known_by_projection supercontig:Nleu1.0:GL397658.1:12043:59033:-1 gene:ENSNLEG00000001249 transcript:ENSNLET00000001563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPLATSAFLRFRLSFCLSHVLRGRRSWDFKVYRLFYGECTPMRERAVSSELSPSVQEQ
NKMNKVEQKFQGSVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCVHKP
EVIFRLEQGEEPWRLEEEFPSQSFPEVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
GNVIGIPFNMDVSSFPSRKKFCQCDSCGMSFNTVSQLVISKINYLGKKSDEFNACGKLLF
NIKHDETRTQEKNEVLKNRKTLSHHENTLQHEKIQTLEHNFEYNICQETLLEKAVFNTWK
SENAEENNCEYNEFGRTLCDSSSLLFHQIPPSKDSHYEFSDCEKFLYMKSTLSKHHGVPM
KHYDCGESGNNFRRKLCLSQLQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGEKRFQ
CNVCGKTFWEKSNLTKHQRSHTGEKPFECNECRKAFSHKSALTLHQRTHTGEKPYQCNAC
GKTFYQKSDLTKHQRTHTGLKPYECYECGKSFCMNSHLTVHQRTHTGEKPFECLQCGKSF
CQKSHLTQHQRTHIGDKPYECNACGKTFYHKSVLNRHQIIHTGLKPYECYECGKTFCLKS
DLTVHQRTHTGEKPFACPECGKFFSHKSTLSQHYRTHTGENPYECHECGKIFYNKSYLTK
HNRTHTGEKPYKCNECGKTFCQKSQLTQHQRIHIGEKPYECNECGKAFCHKSALIVHQRT
HTQEKPYKCNECGKSFCVKSGLILHERKHTGEKPYECNQCGKSFSHKSSLTVHHRAHTGE
KSCRCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRTHIGEKPYE
Download sequence
Identical sequences XP_003282160.2.23891 ENSNLEP00000001480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]