SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001781 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001781
Domain Number 1 Region: 180-300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000612
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001781
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001781   Gene: ENSNLEG00000001507   Transcript: ENSNLET00000001884
Sequence length 324
Comment pep:known_by_projection supercontig:Nleu1.0:GL397507.1:1242531:1251063:1 gene:ENSNLEG00000001507 transcript:ENSNLET00000001884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCDSSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHVGYQGPLCTDC
MDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAETPP
CSAAQFCKNANGSYTCEDVDECSLAEKACVRKNENCYNTPGSYVCVCPDGFEETEDACVP
PAEAGEWHGSLHTGCPPLHGGACT
Download sequence
Identical sequences G1QLG6
XP_012363265.1.23891 ENSNLEP00000001781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]