SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001924 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001924
Domain Number 1 Region: 139-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000541
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 42-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000309
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 6-46
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000994
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001924   Gene: ENSNLEG00000001621   Transcript: ENSNLET00000002034
Sequence length 268
Comment pep:novel supercontig:Nleu1.0:GL397417.1:123537:140384:-1 gene:ENSNLEG00000001621 transcript:ENSNLET00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEGQTLFMPSLSRAHSGVYTCKASNSISGLHSSVDTIITVSETLPQPNVTASNLAPVEH
VASISLHCLSLRSTVAIHRYVNGQKLFVGGHREVSLDCRTLTLWNITRNDTGVYQCESWN
SATSSISNPTLVKVIYGSDPHMVNPPDPEVTAGAALTLSCFADSNPPAQYHWEMDRRPGP
ATQHLVISEVTLDQEGRYTCEASNSLTHLRGSVNGKIWISEVPGDGLQPALLRATIPAGG
IAGIALGVLISVVLTGTAGYFVGVIRSQ
Download sequence
Identical sequences ENSNLEP00000001924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]