SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002053 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002053
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.01e-44
Family N-terminal domain of cbl (N-cbl) 0.00034
Further Details:      
 
Domain Number 2 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 2.72e-38
Family EF-hand modules in multidomain proteins 0.00015
Further Details:      
 
Domain Number 3 Region: 288-358
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-36
Family RING finger domain, C3HC4 0.00018
Further Details:      
 
Domain Number 4 Region: 234-315
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000159
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002053   Gene: ENSNLEG00000001721   Transcript: ENSNLET00000002166
Sequence length 428
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:328402:348986:1 gene:ENSNLEG00000001721 transcript:ENSNLET00000002166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCGDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGPGDFLLIYLANLEAKSRQVAALLPPRGQRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHIFWRERCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQEHLQACRDKPGSFELPGAVAHTCNPSTLGGRGGHEPPQPAEEQLQLYWAMDS
TFELCKICAESNKDVKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCEIKGREAVSIYQFHG
QATAEDSGDSSDQEGRELELEQVPLSAPPLPPRPDLPPRKPRNAQSKARLLKGNSPPAAL
GPQDPAPA
Download sequence
Identical sequences ENSNLEP00000002053 ENSNLEP00000002053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]