SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002114 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002114
Domain Number 1 Region: 287-375
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.09e-36
Family Small-conductance potassium channel 0.0000703
Further Details:      
 
Domain Number 2 Region: 189-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-24
Family Voltage-gated potassium channels 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002114   Gene: ENSNLEG00000001764   Transcript: ENSNLET00000002230
Sequence length 426
Comment pep:known_by_projection supercontig:Nleu1.0:GL397530.1:449893:463625:-1 gene:ENSNLEG00000001764 transcript:ENSNLET00000002230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGDLMLGLGALRLRKRLLEXXXXXXXXXXXXXGTGIGLMVLHAEMLWFGGCSVSGAWWL
GAGTRRRGPPPDLLLTPPFLAPSRQLFMTDNGLLDWRVALTWRQAAQITLELVVCGLHPA
PVRAPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESRAVRRHQRRLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQS
Download sequence
Identical sequences ENSNLEP00000002114 ENSNLEP00000002114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]