SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002149 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002149
Domain Number 1 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 244-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 68-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 188-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000896
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 10 Region: 621-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000779
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002149   Gene: ENSNLEG00000001799   Transcript: ENSNLET00000002265
Sequence length 679
Comment pep:known_by_projection supercontig:Nleu1.0:GL397530.1:523381:534549:1 gene:ENSNLEG00000001799 transcript:ENSNLET00000002265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCSVTQAGVQRCDLGSLPAPPPGFTPFSCLSLPSSWDYSSGFSGFCASPIEESHGALI
SSCNSRTMTDGLVTFRDVAIDFSQEEWECLDPAQRDLYVDVMLENYSNLVSLDLESTTYE
TKKIFSEKDIFEISFSQWEMKEKSKTIGLEASIFRNNWKCKSIFEGLKGHQEGYFSQMII
SYEKIPSYRKSKSLTPHQIIRNTEKSYVCKECGKACSHGSKLVQHERTHTAEKHFECKEC
GKNYLSAYQLNVHQRFHTGEKPYECKECGKTFSWGSSLVKHERIHTGEKPYECKECGKAF
SRGYHLTQHQKIHIGVKSYKCKECGKAFFWGSSLAKHEIIHTGEKPYKCKECGKAFSRGY
QLTQHQKIHTGKKPYECKICGKAFCWGYQLTRHQIFHTGEKPYECKECGKAFNCGSSLIQ
HERIHTGEKPYECKECGKAFSRGYHLSQHQKIHTGEKPFECKECGKAFSWGSSLVKHERV
HTGEKSHECKECGKTFCSGYQLTRHQVFHSGEKPYECKECGKAFNCGSSLVQHERIHTGE
KPYECKECGKAFSRGYHLTQHQKIHTGEKPFKCKECGKAFSWGSSLVKHERVHTNEKSYE
CKDCGKAFGSGYQLSVHQRFHTGEKLYQCKEFRKTFTHGSKLVHERTHSNDKPYKYNECG
EAFLWTTYSNEKTDTNETL
Download sequence
Identical sequences ENSNLEP00000002149 ENSNLEP00000002149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]