SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002604 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002604
Domain Number 1 Region: 37-210
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-24
Family G-type lysozyme 0.00000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002604   Gene: ENSNLEG00000002136   Transcript: ENSNLET00000002742
Sequence length 212
Comment pep:known_by_projection supercontig:Nleu1.0:GL397456.1:1743385:1754880:-1 gene:ENSNLEG00000002136 transcript:ENSNLET00000002742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVVFWGLIALIGTSRGSYPFTHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFK
SGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Download sequence
Identical sequences A0A2I3S5Y2 G1QNT8
XP_003279286.1.23891 XP_003805457.1.60992 XP_009441243.1.37143 XP_016804583.1.37143 XP_016804584.1.37143 9598.ENSPTRP00000021037 ENSNLEP00000002604 ENSPTRP00000021037 ENSNLEP00000002604 ENSPTRP00000021037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]