SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003240 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003240
Domain Number 1 Region: 145-339
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 8.12e-18
Family YhfI-like 0.066
Further Details:      
 
Domain Number 2 Region: 42-145
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000072
Family Ring hydroxylating alpha subunit ISP domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003240   Gene: ENSNLEG00000002686   Transcript: ENSNLET00000003402
Sequence length 613
Comment pep:novel supercontig:Nleu1.0:GL397291.1:16155136:16216030:-1 gene:ENSNLEG00000002686 transcript:ENSNLET00000003402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNRNETSNCCSFKIPRERNRQTMGSIEQTTEILLCLSPVEVANLKEGINFFRNKSTGKD
YILYKNKSRLRACKNMCKHQGGLFIKDIEDLAGRSVRCTKHNWKLDVSTMKYINPPESFC
QDELVVEMDENNGLLLLELNPPNPWDSQPRSPEELAFGEVQITYLTHACMDLKLGDKRMV
FDPWLIGPAFARGWWLLHEPPSDWLERLCQADLIYISHLHSDHLSYPTLKKLAGRRPDIP
IYVGNTERPVFWNLNQSGVQLTNINVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEY
KGHKILNTVDCTRPNGGRLPMKVALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERK
KLLNYKARLVKNLQPRIYCPFAGYFVESHPSDKYIKETNTKNDPNELNNLIKKNSDVITW
TPRPGATLDLGRMLKDPTDSKGIIEPPEGTKIYKDSWDFEPYLEILNAAVGDEIFLHSSW
IKEYFTWAGFKDYNLVVRMIETDEDFNPFPGGYDYLVDFLDLSFPKERPQREHPYEEIHS
RVDVIRHVVKNGLLWDELYIGFQTRIQRDPDIYHHLFWNHFQIKLPLTPPNWKSFLTCCE
QNGPGILQECKTT
Download sequence
Identical sequences ENSNLEP00000003240 XP_012364585.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]