SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003508 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003508
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily L domain-like 3.33e-36
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 279-358
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000063
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003508   Gene: ENSNLEG00000002896   Transcript: ENSNLET00000003681
Sequence length 493
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:4860964:4863842:-1 gene:ENSNLEG00000002896 transcript:ENSNLET00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKV
WVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
Download sequence
Identical sequences A0A096MMY0 A0A0D9SAD9 A0A2K5HG05 A0A2K5L3K5 A0A2K5XLD8 A0A2K6AX36 A0A2K6KIX4 A0A2K6NL35 F6VL60 G1QRE0 G3S862 G7NV59 H2PZK7 Q86WK6
ENSP00000358878 ENSP00000358880 ENSMMUP00000007668 9544.ENSMMUP00000007668 9598.ENSPTRP00000001819 9606.ENSP00000358878 ENSP00000358878 ENSPTRP00000001819 ENSNLEP00000003508 ENSGGOP00000024274 ENSGGOP00000024274 ENSPTRP00000001819 ENSP00000358878 ENSP00000358880 NP_001244799.1.72884 NP_065754.2.87134 NP_065754.2.92137 XP_001150542.1.37143 XP_003267951.1.23891 XP_003267952.1.23891 XP_003804944.1.60992 XP_004026317.1.27298 XP_005542523.1.63531 XP_005542524.1.63531 XP_007975875.1.81039 XP_007975876.1.81039 XP_008962985.1.60992 XP_008962990.1.60992 XP_009425600.1.37143 XP_009425606.1.37143 XP_010353858.1.97406 XP_011540114.1.92137 XP_011735531.1.29376 XP_011735532.1.29376 XP_011735533.1.29376 XP_011803504.1.43180 XP_011824089.1.47321 XP_011933663.1.92194 XP_011933664.1.92194 XP_011933665.1.92194 XP_011933666.1.92194 XP_011933667.1.92194 XP_015002291.1.72884 XP_017714290.1.44346 XP_017714291.1.44346 XP_018868174.1.27298 ENSMMUP00000007668 ENSPANP00000000965 ENSNLEP00000003508 NYSGRC-IgSF-AMGO1_HUMAN gi|153791466|ref|NP_065754.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]