SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003573 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003573
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.14e-36
Family Cap-Gly domain 0.00083
Further Details:      
 
Domain Number 2 Region: 105-369
Classification Level Classification E-value
Superfamily L domain-like 3.74e-27
Family Internalin LRR domain 0.016
Further Details:      
 
Domain Number 3 Region: 439-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.87e-22
Family Ubiquitin-related 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003573   Gene: ENSNLEG00000002823   Transcript: ENSNLET00000003748
Sequence length 527
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:4874097:4959305:1 gene:ENSNLEG00000002823 transcript:ENSNLET00000003748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTLTPNVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFK
CRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPDEDRKEQIVTIGNKPVETIGFDSLM
RQQSQLSKLQEVSLRNCAVSCAGEKGGAAEACPNIRKVDLSKNLLSSWDEVIHIAGQLRH
LEVLNVSENKLKFPSGSVLTGTLSALKILVLNQTGIKWAEVLRCAAGCPGLEELYLESDN
IFISERPTDVLQTIKLLDLSSNQLIDENQLYLIAHLPRLEKLILSDIGISSLHFPDAGIG
CKTSMFPSLKYLVVNDNQISQWSFFNELDKLPSLRALSCLRNPLTKENKEAETARLLIIA
SIGQLETLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPDKNRLSEEFLIAHPRYQL
LCLKYGAPEDWELKTQQPFMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSR
LLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Download sequence
Identical sequences G1QRK5
XP_003267329.1.23891 XP_003267331.1.23891 ENSNLEP00000003573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]