SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004281 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004281
Domain Number 1 Region: 1250-1447,1475-1499
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 935-1083,1121-1198
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.2e-24
Family Voltage-gated potassium channels 0.028
Further Details:      
 
Domain Number 3 Region: 504-730
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-24
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 117-262,332-400
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-20
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004281
Domain Number - Region: 1505-1550
Classification Level Classification E-value
Superfamily EF-hand 0.00191
Family Polcalcin 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004281   Gene: ENSNLEG00000003497   Transcript: ENSNLET00000004505
Sequence length 1682
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:11726872:11811610:-1 gene:ENSNLEG00000003497 transcript:ENSNLET00000004505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASPEPKGLVPFTKESFELIKQHIAKTHNEEHEEEDLKPNPDLEVGKELPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLSKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFF
RLFILISVLIDCIFMSLTNLPKWRPVLENTLLGIYTFEILVKFFARGVWAGSFSFLGDPW
NWLDFCVTVFEIIIRYSPLDFIPMLQTARTLRILKIIPLNQGLKSLVGVLIHCLKKLIGV
IILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEG
ERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYH
QILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIESKFQQTGK
ELQEGNETDESKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAK
TFLIWNCSPSWLKLKEFVHRIVRAPFTDLFLIICIILNVCFLALEHYPMSKQTNNLLDIG
NLVFIGIFTAEMILKIIAMHPYGYFQVGWNIFDSMIVFHGLIELCLADVAGMALLRLFRM
LRIFKLGKYWPTFQILMWSLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGQNYEEFVCHI
DKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLV
LYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKTQNVPKDTMDH
VNEVYVKEDISDYTLSELSNTQDFLKDKEKSSGTEKNTTENESQSLIPSPSVSETVPIAS
GESDIENLDNKEIQSKSGDGGSKEKIKPSSSSECSTVDIAISEEEEMFYGGERSKHPKNG
CGRGSSLGQISGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYIDQ
RKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTR
EELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFGIMGVDLF
AGRFYECIDPTSGERFPSSEVMNRSQCESLLFNESMPWENAKMNFDNVGNGFLSLLQVAT
FNGWITIMNSAIDSVAVNTQPHFEVNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHK
IKLGGSNIFITVKQRKQYRRLKKIMYEDSERPIPRPLNKLQGFIFDVVTSQVFNVIVMVL
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVTLYTMECILKLIAFRCFYFTIAWNIFDFM
VVIFSITGLCLPATVGSYLVPPSLVQLMLLSRIIHMLRLGKGPKVFHNLMLPLMLSLPAL
LNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVAIFAGWDGML
DAIFNSKRSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLN
IASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALEPPLFMAKPNKGQLI
ALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVLSEIESGFLLANPFKITCEPITTTL
KRKQEAVSATIIQRAYKNYRLRRNDKNTSDTHRIDGDRDVHTTKEGAYFDKAKEKSPIQS
QI
Download sequence
Identical sequences G1QTL3
ENSNLEP00000004281 XP_003266244.1.23891 XP_012351738.1.23891 ENSNLEP00000004281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]