SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004321 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004321
Domain Number 1 Region: 142-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-44
Family Dual specificity phosphatase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 12-140
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.91e-26
Family Cell cycle control phosphatase, catalytic domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004321   Gene: ENSNLEG00000003556   Transcript: ENSNLET00000004546
Sequence length 662
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:3749275:3794588:-1 gene:ENSNLEG00000003556 transcript:ENSNLET00000004546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSVDEAYRFVKEKRPTISPNFNFLGQLLEYEKKIKN
QTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASV
PSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSS
EDALEYYKPSTALDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKPQTTRPSDSQSKR
LHSVRTSSGGTTQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWHSDI
LAPQTSTPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKP
SDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIE
VS
Download sequence
Identical sequences G1QTQ3
ENSNLEP00000004321 ENSNLEP00000023632 XP_012357949.1.23891 ENSNLEP00000004321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]