SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004458 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004458
Domain Number 1 Region: 2-261,352-411,440-447
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.93e-23
Family Glycerol-3-phosphate transporter 0.053
Further Details:      
 
Domain Number 2 Region: 273-313
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000374
Family Ovomucoid domain III-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004458   Gene: ENSNLEG00000003683   Transcript: ENSNLET00000004693
Sequence length 475
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:10184307:10282007:-1 gene:ENSNLEG00000003683 transcript:ENSNLET00000004693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLMVVAQLLAGIGTVPIQPFGISYVDDFSEPSNSPLYISILFAISVFGPAFGYLLGSV
MLQIFVDYGRVNTAAVNLVPGDPRWIGAWWLGLLISSALLVLTSFPFFFFPRAMPIGAKR
APATTDEARKLEDAKSRGSLVDFIKRFPRIFLRLLMNPLFVLVVLAQCTFSSVIAGLSTF
LNKFLEKQYGTSAAYANFLIGAVNLPAAALGMLFGGILMKRFVFSLQTIPRVATTIITIS
MILCVPLFFMGCSTPTVAEVYPSSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLS
PCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLI
ACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCL
GRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI
Download sequence
Identical sequences ENSNLEP00000004458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]