SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004631 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004631
Domain Number 1 Region: 614-915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-84
Family Protein kinases, catalytic subunit 0.000000000319
Further Details:      
 
Domain Number 2 Region: 19-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-76
Family Ephrin receptor ligand binding domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-38
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 4 Region: 908-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.28e-20
Family SAM (sterile alpha motif) domain 0.0002
Further Details:      
 
Domain Number 5 Region: 252-325,360-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000267
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004631   Gene: ENSNLEG00000003807   Transcript: ENSNLET00000004870
Sequence length 984
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:10999634:11467321:1 gene:ENSNLEG00000003807 transcript:ENSNLET00000004870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAG
HQKKILNSIHSMRVHMSQSPTAMA
Download sequence
Identical sequences G1QUL1
ENSNLEP00000004631 ENSNLEP00000004631 XP_003265303.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]