SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004632 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004632
Domain Number 1 Region: 97-212
Classification Level Classification E-value
Superfamily Fibronectin type III 7.81e-31
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 21-120
Classification Level Classification E-value
Superfamily Fibronectin type III 9.84e-21
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004632   Gene: ENSNLEG00000003835   Transcript: ENSNLET00000004871
Sequence length 325
Comment pep:novel supercontig:Nleu1.0:GL397293.1:18774663:18810661:1 gene:ENSNLEG00000003835 transcript:ENSNLET00000004871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNLLQWESPAFAKGNLTFTAQYLSYR
IFQDKCMSTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMRNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTNDETVPSWMVAVILMASVFVVCLALLG
CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
DSESGKQNPGDSCSLGTPPGQGPQS
Download sequence
Identical sequences G1QUL2
ENSNLEP00000004632 ENSNLEP00000004632 XP_003263916.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]