SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004669 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004669
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 3.95e-19
Family mono-SIS domain 0.006
Further Details:      
 
Domain Number 2 Region: 29-278
Classification Level Classification E-value
Superfamily SIS domain 0.00000000568
Family mono-SIS domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004669   Gene: ENSNLEG00000003810   Transcript: ENSNLET00000004909
Sequence length 625
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:6798770:6825699:1 gene:ENSNLEG00000003810 transcript:ENSNLET00000004909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEI
FQEEGQALPTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVASGKKRVIVIGISV
GLSAPFVAGQMDYCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
KAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFE
RAHQVTYSQSPKIATLMKSISTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFQDV
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ
TLVEQVKEKTSHIQALAHSTVGQTLPIPLKRLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLR
AIHFPQPLSDDIRAAPISCHVQVAHEKEQVIPIALLSLLFRCSITEAQAHLAAAPSVCEA
VRSALAGPGQKRTADPLEILEPDVQ
Download sequence
Identical sequences G1QUP9
XP_003270708.1.23891 ENSNLEP00000004669 ENSNLEP00000004669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]