SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004736 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004736
Domain Number 1 Region: 810-1000
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.07e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 44-424
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-58
Family L-arabinose binding protein-like 0.00066
Further Details:      
 
Domain Number 3 Region: 506-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.12e-46
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004736   Gene: ENSNLEG00000003853   Transcript: ENSNLET00000004981
Sequence length 1073
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:5922463:6009046:-1 gene:ENSNLEG00000003853 transcript:ENSNLET00000004981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLDLALWSLLFQTGWLSWSSQVSQNCHNGSYEISVLMMDNSAFAEPLENLEDAVKE
GLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISHAKRMGCVLI
GPSCTYSTFQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSPARKLTYFLVNFWKTNDL
PFKTYSWSTSYVYKNGTETEDCFWYLNALEASVSYFSHELSFKVVLRQDKEFQDILTDHN
RRSNVIIMCGGPEFLYKLKGDRAVAEDTVIILVDLFNDQYFEDNVTAPDYMKNVLVLTLS
PGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLKIFLENGENITTPKFAHAFRNLTF
EGYDGPVTLDDWGDVDSTMVLLYTSVATKKYKVLLTYDTHVNQTYPVDMSPTFTWKNSKL
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYKKDYELRQKKWSHIPPENIFPLE
TNETNHVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQK
GDVYSYGVIAQEIILRKETFYTLSCRDQNEKIFRVENSNGMKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEI
LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQ
RLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTDKESTYF
Download sequence
Identical sequences G1QUW6
XP_003265576.1.23891 ENSNLEP00000004736 ENSNLEP00000004736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]