SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004903 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004903
Domain Number 1 Region: 78-158
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000525
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004903   Gene: ENSNLEG00000004054   Transcript: ENSNLET00000005155
Sequence length 233
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:1647632:1649701:-1 gene:ENSNLEG00000004054 transcript:ENSNLET00000005155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEEDETETAWPPLPAVPCDYDHCRHLQVPC
KELQRAGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPYSPVLHYWLLLWD
GSGPPLNATVRRAELKGLKPGGVYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSR
LAVPPNPRTLVHAAVGVGTALALLSCAALVWHFCLRDRWGCPRRAAARAAGAL
Download sequence
Identical sequences G1QVD2
XP_003274142.1.23891 ENSNLEP00000004903 ENSNLEP00000004903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]