SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004993 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004993
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Fibronectin type III 5.84e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 121-225
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000151
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004993   Gene: ENSNLEG00000004107   Transcript: ENSNLET00000005251
Sequence length 311
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:13162043:13205575:1 gene:ENSNLEG00000004107 transcript:ENSNLET00000005251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEAAILPAPQNLSVLSTNMKHLLMWSPVIVP
GKTVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
TSAWSILKQPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPEAAYCVNAQTFVKAIGRYSTFSQIECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGQLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
Download sequence
Identical sequences ENSNLEP00000004993 XP_003265320.1.23891 ENSNLEP00000004993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]