SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005297 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005297
Domain Number 1 Region: 1014-1104
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 835-937
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-24
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 3 Region: 389-500
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-24
Family PDZ domain 0.0000496
Further Details:      
 
Domain Number 4 Region: 698-810
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 552-662
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-18
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 6 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000475
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000128
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000158
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005297   Gene: ENSNLEG00000004350   Transcript: ENSNLET00000005573
Sequence length 1481
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:8755028:9045770:1 gene:ENSNLEG00000004350 transcript:ENSNLET00000005573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDAESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDETLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQAEIRSSKPDMEKSHFTRDPSQLKGVLVRASLKKSAMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQ
NGKSGHTLTGDGLNGPSDTSEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDKKENSGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFISTQNGSPRLNRTEV
PARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRP
MGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQSLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDINNSSSSNVIYDEQSPLLPSSHSASIF
EESHIPVIEESLRVQICEKGEELKDIVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSH
GHGNKKNLLKVENGVTRRGRSVSPKKPASQHSEEHLDKIPSPLKNNPKRRPRDRSLSPSK
GENKSCQVSTRRGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAEAKLLEGKSRRIAGYT
GSNAEQIPDGQEKSDVIRKDAKQNQLEKSRTRSPEKKSKRMVDKSLPSKMTNKTTSKGVS
ENEKGKKVTTGETSSSNDKIGEHVQLSEKRLKQEPEEKVVSNKTEDHKGKEQEAADKNKE
TGRFKPESSSPVKKTPITPGPWKVPSGNKVTGTIGMAEKRQ
Download sequence
Identical sequences ENSNLEP00000005297 XP_003268044.1.23891 ENSNLEP00000005297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]