SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005364 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005364
Domain Number 1 Region: 210-294
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.23e-25
Family Thyroglobulin type-1 domain 0.00023
Further Details:      
 
Domain Number 2 Region: 48-118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-16
Family Growth factor receptor domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005364   Gene: ENSNLEG00000004368   Transcript: ENSNLET00000005642
Sequence length 296
Comment pep:known_by_projection supercontig:Nleu1.0:GL397320.1:10500453:10509369:-1 gene:ENSNLEG00000004368 transcript:ENSNLET00000005642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRARPTLWAAALTVLVLLRGLPVARAGASSAGLGPVVRCXXXXARALAQCAPPPTVCAE
LVREPSCGCCTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVS
RLRAYLLPAPPAPGEPPAPGNASESEEDRSASSVESPSVSSTHRVSDPKFHPLHSKIIVI
KKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGV
HIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Download sequence
Identical sequences ENSNLEP00000005364 ENSNLEP00000005364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]