SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005386 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005386
Domain Number 1 Region: 76-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.31e-49
Family Astacin 0.00023
Further Details:      
 
Domain Number 2 Region: 432-601
Classification Level Classification E-value
Superfamily TRAF domain-like 9.81e-38
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 270-433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-28
Family MAM domain 0.0048
Further Details:      
 
Domain Number 4 Region: 674-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005386   Gene: ENSNLEG00000004415   Transcript: ENSNLET00000005667
Sequence length 748
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:11127563:11178951:-1 gene:ENSNLEG00000004415 transcript:ENSNLET00000005667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTRSTCILFFTLFFAHIAAVPIKYLPKENVQMHREYFGEQKDISEINLAAGLDLFQGD
ILLRKSRNGLRDPNTRWTFPIPYILADNLELNAKGAILYAFEMFRLKSCVDFKPYEGESS
YIIFQQFDGCWSEVGDQHVGQNLSIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNI
WWDQILSGYQHNFDTYDDSLITDLNTPYDYESVMHYQPFSFNKNASVPTITAKIPEFNSV
IGQRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMIQGTRDDTDWVHQDTAQAG
EVDHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRL
VVWVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGG
IYLDDITLTETPCPTGVWTVRNFSQVLENTSEGDRLQSPRFYNSEGYGFGLTLYPNGRES
SGYLRLAFHVCSGENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKLHTSAVI
NDTCIWDRPSRVGTYHTDCNCFRSIDMGWSGFISHQMLKRRSFLKNDDLIMFVDFEDITH
LSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAVLEEALPVSLSQGQPSRQKRSVENT
GPLEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGHAFFYTGERCQAMQVHGSV
LGMVIGGTAGMIFLTFSIIAILSQRPRK
Download sequence
Identical sequences ENSNLEP00000005386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]