SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005390 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005390
Domain Number 1 Region: 102-287
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.57e-49
Family Astacin 0.00023
Further Details:      
 
Domain Number 2 Region: 458-627
Classification Level Classification E-value
Superfamily TRAF domain-like 1.05e-37
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 296-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-28
Family MAM domain 0.0048
Further Details:      
 
Domain Number 4 Region: 700-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005390   Gene: ENSNLEG00000004415   Transcript: ENSNLET00000005671
Sequence length 774
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:11127563:11178939:-1 gene:ENSNLEG00000004415 transcript:ENSNLET00000005671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTRSTCILFFTLFFAHIAAVPVSRVLLFGYLEILILVYIIHFLYIYFFQIKYLPKENV
HDADFGEQKDISEINLAAGLDLFQGDILLRKSRNGLRDPNTRWTFPIPYILADNLELNAK
GAILYAFEMFRLKSCVDFKPYEGESSYIIFQQFDGCWSEVGDQHVGQNLSIGQGCAYKAI
IEHEILHALGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESVM
HYQPFSFNKNASVPTITAKIPEFNSVIGQRLDFSAIDLERLNRMYNCTTTHTLLDHCTFE
KANICGMIQGTRDDTDWVHQDTAQAGEVDHTLLGQCTGAGYFMQFSTSSGSAEEAALLES
RILYPKRKQQCLQFFYKMTGSPSDRLVVWVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAH
VVLKEEQKFRYLFQGTKGDPQNSTGGIYLDDITLTETPCPTGVWTVRNFSQVLENTSEGD
RLQSPRFYNSEGYGFGLTLYPNGRESSGYLRLAFHVCSGENDAILEWPVENRQVIITILD
QEPDVRNRMSSSMVFTTSKLHTSAVINDTCIWDRPSRVGTYHTDCNCFRSIDMGWSGFIS
HQMLKRRSFLKNDDLIMFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGK
AVLEEALPVSLSQGQPSRQKRSVENTGPLEDHNWPQYFRDPCDPNPCQNDGICVNVKGMA
SCRCISGHAFFYTGERCQAMQVHGSVLGMVIGGTAGMIFLTFSIIAILSQRPRK
Download sequence
Identical sequences ENSNLEP00000005390 ENSNLEP00000005390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]