SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005523 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005523
Domain Number 1 Region: 24-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005523   Gene: ENSNLEG00000004445   Transcript: ENSNLET00000005807
Sequence length 807
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:9173793:9232836:-1 gene:ENSNLEG00000004445 transcript:ENSNLET00000005807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQREILQKFLDEAQSKKINKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWILLKDGIIPENFSVFSLIWEMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKYSIPEQNHTLQADSYSPKLPKSTIKAAKMMNQQRTKMENKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKRQTKAFPTVGEPLQKHKSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVYSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQICNASNVKHHDSSALGVYSYIPLVEDPYLSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFPYYNSHDSLSLNSPTNISPLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEDVGEFSPNVPKSLSSAVKVKVGTSLEWGGTS
EPKKFDDSVRLRPSKSVKLQSPKSELRQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQILKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
Download sequence
Identical sequences G1QX52
ENSNLEP00000005523 XP_003268047.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]