SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005786 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005786
Domain Number 1 Region: 424-674
Classification Level Classification E-value
Superfamily RNI-like 5.69e-37
Family 28-residue LRR 0.024
Further Details:      
 
Domain Number 2 Region: 164-376,414-442
Classification Level Classification E-value
Superfamily RNI-like 9.62e-28
Family 28-residue LRR 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005786   Gene: ENSNLEG00000004765   Transcript: ENSNLET00000006090
Sequence length 1431
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:20325273:20337586:1 gene:ENSNLEG00000004765 transcript:ENSNLET00000006090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTPDGISCELRGEITRFLWPKEVELLLKTWLPGEGAVQNHVLALLRWRAYLLHTTCLP
LRVDCTFSYLEVQAMALQETPPQVTFELESLRELVLEFPGVAALEQLAQHVAAAIKKVFP
CSTLGKLFRRPTPASMLARLERRSPSESTDPCSPCGGFLETYEALCDYNGFPFREEIQWD
VDTIYHRQGCRHFSLGDFSHLGSRDLALSVAALSYNLWFRCLSCVDMKLSLEVSEQILHM
MSQSSHLEELVLETCGLRGDFVRRLAQAMAGHSSSGLRELSLAGNLLDDRGMAALSRHLE
RCPGALRRLSLAQTGLTPRGMRALGRALATNATFDSALTHLDLSGNPGALGASEDSGGLY
SFLSRPNVLSFLNLAGTDTALDTVRGCSVGGWMTGRADWRAGRGGLGPPAGAANSLPSQL
FAALSGGCCISLIHLDASRNVFSRTKSRAAPAAMQLFLSRARTLRHLGLAGCKLPPDALR
ALLDGLALNTHLRDLHLDLSACELRSAGAQVIQDLVCDAGAVSSLDLADNGFGSDMVTLV
LAIGRSRSLRHVALGRNFHVRCKALTLLXXXXWLFSPQPLQSLSVAESRLKLGASVLLRA
LATNPNLTALDISGNAMGDAGAKLLAKALRVNSRLRSVVWDRNHTSALGLLDVAQALEQN
HSLKAMPLPLNDVAQAQRSRPELTARAVHQIQACLLRNNRADPASSDHTTHLQPLGLVSD
PSEQEVNELCQSVQEHVELLGCGAGPQGEAAVHQAEDAIQNANFSLSILPILYEAGSSPS
HHWQLGQKLEGLLGQVGEVCRQDIKDFTQATLDTARSLCPQMLQGSSWREQLEGVLAGSR
GLPELLPEQLLQDAFTRLRDMRLSITGTLAESIVAQALAGLSAARDRLVESLAQQATVTM
PPALPAPDRGEPSLLEPWELEGLFFPEENEEEKEKDDSPLQKWPELSHGLHLVPFIHSAA
EETEPEPELAAPGEDAEPQAGPSARGSPSPAAPGPPAGPLPRMDLPPAGQPLRHPTRARP
RPRRQHHHRPPPGGPQVPPALPQEGNGLSARVDEGVEEFFSKRLIQQDRLWAPEEDPATE
GGATPVPRTLRKKLGTLFAFKKPRSTRGPRPDLETSPGAAPRTRKTTFGDLLRPPTRPSR
GEEPGGAEGDTSSPDPARRSRPRYTRDSKAYSMILLPAEEEATLGARPDKRRPLERGETE
LAPSFEQRVQVMLQRIGVSRGSGGAEGKRKQSKDGEIKKAGSDGDIMDSSTEAPPISIKS
RTHSVSADPSCRPGPGNQGPESATWKTLGQQLNAELRSRGWGQQDGPGPPSPGQSPSPCR
TSPSPDSLGLPEDPCLGPRNEDGQLRPRPLSAGRRAVSVHEDQLQAPAERPLRLQRSPVL
KRRPKLEAPPSPSLGSGLGTEPLPPQPTEPSSPERSPPSPATDQRGGGPNP
Download sequence
Identical sequences ENSNLEP00000005786 ENSNLEP00000005786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]