SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005983 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005983
Domain Number 1 Region: 200-396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-39
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 59-129
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000167
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005983   Gene: ENSNLEG00000004940   Transcript: ENSNLET00000006294
Sequence length 399
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:6885644:7022351:-1 gene:ENSNLEG00000004940 transcript:ENSNLET00000006294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQRGKRQNAGLGEKGXXXXXSRGGPPSARSKAVTVVAEGAASRSWLSMDAPELGPGLVER
LEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPPATGTEASPTACPSCGLPCPRR
SLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVP
TSKSSNSEDDLPEDYPVVKNMLHRLTADLTLDAGTAHRRLLISADRRSVQLAPPGTPAPP
DGPKRFDQLPAVLGAQGFGAGRHCWEVETAEAASCRDSSGEDEDDEESHYAVGAAGESVQ
RKGCVRMCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEPPPRRIRVDLDWERGRVAFYDG
RSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAKS
Download sequence
Identical sequences ENSNLEP00000005983 ENSNLEP00000005983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]