SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006142 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006142
Domain Number 1 Region: 404-490
Classification Level Classification E-value
Superfamily DEATH domain 2.36e-19
Family DEATH domain, DD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006142   Gene: ENSNLEG00000005072   Transcript: ENSNLET00000006458
Sequence length 518
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:18776772:18789476:1 gene:ENSNLEG00000005072 transcript:ENSNLET00000006458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNSQEEPVSQTTPPP
ENEVSRQHLPATLPEMVAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDT
GISLLIPPGAVAVGRQERVSLILVWDLSDAPSLSRAQGLVSPVVACGPHGASFLKPCTLT
FKHCAEQPSHARTYSSNTTLLDTKVWRPLGRPGAHASRDECRIHLSHFSLYTCVLEAPVG
REARKWLQLAVFCSPLAPGQSHLQLRIYFLNNTPCALQWALTNEQPHGGRLRGPCQLFNF
NGARGDQCLKLKYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAANENEDCSAL
TNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLL
EPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYFMTVMER
LDCASAIQNYLSGTHGGSPGLERGGVQDNQGLELDEKL
Download sequence
Identical sequences G1QYX1
ENSNLEP00000006142 XP_003266356.1.23891 XP_012351743.1.23891 ENSNLEP00000006142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]