SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006247 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006247
Domain Number 1 Region: 22-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000244
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 2 Region: 149-260
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000203
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 3 Region: 699-812
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000685
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 4 Region: 439-535
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000958
Family I set domains 0.072
Further Details:      
 
Domain Number 5 Region: 837-947
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000563
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 6 Region: 573-666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000121
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 7 Region: 291-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000256
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006247
Domain Number - Region: 976-1013,1049-1112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000222
Family C1 set domains (antibody constant domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006247   Gene: ENSNLEG00000005162   Transcript: ENSNLET00000006564
Sequence length 1216
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:11994061:12086264:-1 gene:ENSNLEG00000005162 transcript:ENSNLET00000006564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCFFPVLSCLAVLGVVSAQRQVTVQEGPLYRTEGSHITIWCNVSGYQGPSEQNFQWSIY
LPSSPEREVQIVSTMDSSFPYAIYTQRVRGGKIFIERVEGNSTLLHITDLQARDAGEYEC
HTPSTDKQYFGSYSAKMNLVVIPDSLQTTAMPQTLHRVEQDPLELTCEVASETVQHSHLS
VAWLRQKVGEKPVEVISLSRDFMLHSGSEYAQRQSLGEVRLDKLGRTTFRLTIFHLQPSD
QGEFYCEAAEWIQDPDGSWYAMTRKRSEGAVVNVQPTDKEFTVRLETEKRLHTVGEPVEF
RCILEAQNVPDRYFAVSWAFNSSLIATMGPNAVPVLNSEFAHREARGQLKVAKESDSVFV
LKIYHLRQEDSGKYNCRVTEREKTVTGEFIDKESKRPKNIPIIVLPLSKRDVLLSSPCVS
LSLFLESSISVEVASNASVILEGEDLRFSCSVRTAGRPQGRFSVIWQLVDRQNRRSNIMW
LDRDGTVQPGSSYWERSSFGGIQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRAVDG
EWQIVGERRASTPISITALEMGFAVTAISRTPGVTYSDSFDLQCIIKPHYPARVPVSVTW
RFQPVGTVEFHDLVTFTRDGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAGK
YQCVAELWRKNHNNTWTRLAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNCS
VKSQTSQNSHFAVLWYVHKPSDADGKLILKTTHNSAFEYGTYAEEEGLRARLQFERHVSG
GLFSLTVQRAEVSDSGSYYCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQA
QGNLSVLETRQVQLECVVLNRTSITSQLMVEWFVWKPNHPERETVARLSRDATFHYGEQA
AKNNLKGRLHLESPSPGVYRLFIQNVAVQDSGTYSCHVEEWLPSPSGMWYKRAEGTAGQT
ALTVMRPDASLQVDTVVPNATVSEKAAFQLDCSIVSRSSQDSRFAVAWYSLRTKAGGKRS
SPGLEGQEENSEEEEEVEEEDEEEDDDDPTERTALLSVGPDAVFGPEGSPWEGRLRFQRL
SPVLYRLTVLQASPRDTGNYSCHVEEWLPSPQKEWDYRRPPLRPAILSLSSFSGPTLQSI
ICSNDALFYFVFFYPFPIFGILIITILLVRFKSRNSSKNSDGKNGVPLLWIKEPHLNYSP
TCLEPPVLSIHPGAID
Download sequence
Identical sequences ENSNLEP00000006247 ENSNLEP00000006247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]