SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006304 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006304
Domain Number 1 Region: 519-738
Classification Level Classification E-value
Superfamily Bet v1-like 3.78e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 78-238
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006304   Gene: ENSNLEG00000005136   Transcript: ENSNLET00000006626
Sequence length 747
Comment pep:known_by_projection supercontig:Nleu1.0:GL397303.1:18994044:19136002:-1 gene:ENSNLEG00000005136 transcript:ENSNLET00000006626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHSGIPIPPSPFSAPPAFVTRESRRGLSSGGSAERNAGVTATAADDWKGRLPSPLVLLP
RSARCQARRRRGGRTSSLLLLPPTPERALFASPSPDPSPRGLGASSGAAEGAGAGLLLGC
RASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKS
EDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKT
ESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDT
LQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGIN
GIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTE
LKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGD
AFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDAN
WQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIEN
FHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDS
APLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAV
AKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences G1QZD3
ENSNLEP00000006304 XP_003266123.1.23891 ENSNLEP00000006304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]