SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006472 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006472
Domain Number 1 Region: 176-336
Classification Level Classification E-value
Superfamily HIT-like 1.24e-52
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.016
Further Details:      
 
Domain Number 2 Region: 4-117
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.03e-36
Family FHA domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006472   Gene: ENSNLEG00000005302   Transcript: ENSNLET00000006800
Sequence length 356
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:24655829:24690106:1 gene:ENSNLEG00000005302 transcript:ENSNLET00000006800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVNLSVSDIWRVMMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQ
LKAECNKGYVKVKQVGVNPTSIDSVVIGKDQEMKLQPGQVLHMVNELYPYIVEFEEEAKN
PGLETHRKRKRSGNSDSIERDAAQEAEPGTGLEPGSNPSQCSVPLKKGKDAPIKKESLGH
WSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVSREHLELLKH
MHTVGEKVIVDFAGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEY
FLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLKKHWTQ
Download sequence
Identical sequences XP_003263477.1.23891 ENSNLEP00000006472 ENSNLEP00000006472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]