SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006647 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006647
Domain Number 1 Region: 322-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.63e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 57-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000406
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 143-197,225-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000074
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006647   Gene: ENSNLEG00000005463   Transcript: ENSNLET00000006980
Sequence length 588
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:18740089:18831414:1 gene:ENSNLEG00000005463 transcript:ENSNLET00000006980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAVGSFSSHVTEFPQKRKGSDSDPS
QEAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHLRSLKGLTNSYV
GNNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNYDQASLTGQSLF
DFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNFHTGRTRVYSGSRRSFFCRIKS
CKISVKEEHGRLPNSKKKEHRKFYTIHCTGYLRSWPPSIVGMEEERNSKKDNSNFTCLVA
IGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYF
HQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSV
NTLVLGHSEPGEASFFPCSSQSSEESSRQSCVSVPGMSTGTVLGAGSIGTDIANEILDLQ
RLQSSSYLDDSNPTDLMKDTHTVNCRSMSNKELFPPSPSEMGELEATRQNRSTVAVHSHE
PLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences G1R0C6
ENSNLEP00000006647 XP_003265681.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]