SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007204 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007204
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-35
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 228-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 761-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 678-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 976-1028
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 605-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.12e-16
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 862-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000012
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 832-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000392
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 444-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000161
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007204
Domain Number - Region: 953-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007204   Gene: ENSNLEG00000005957   Transcript: ENSNLET00000007561
Sequence length 1031
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:32947920:32956873:-1 gene:ENSNLEG00000005957 transcript:ENSNLET00000007561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWHAVYPAQAQSSRERGRLQTVKKEEEDESYTPVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNP
ESGEEAVALLEELQRDLDGTSWRDPGPAQSPDVHWMGTGALRSAQIWSLASPLRSSSALG
DHLEPPYEIEARDFLAGQSDTPAAQMPALFQREGCPGDQVTPTRSLTAQLQETMTFKDVE
VTFSQDEWGWLDSAQRNLYRDVMLENYRNMASLVGPFTKPALISWLEAREPWGLNVQAAQ
PKGNPGAAHTGDDLQIKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSR
QKDQCENPIQVRVKKEETNFSQRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKH
FRMSSHHYDYKKYGKGLRHVIGGFSLHQRIHSGLKGNKKDVCGKDFSLSSHHQHGQSLHT
VGVSFKCSDCGRTFSHSSHLAYHQRLHTQEKAFKCRVCGKAFRWSSNCARHEKIHTGVKP
YKCDLCEKAFRRLSAYRLHRETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCS
QCRKSFHCKSYVLEHQRIHTQEKPYKCTKCRKTFRWRSNFTRHMRLHEEEKFYKQDECRE
GFGQSPDCSQPQGAPAVEKTFLCQQCGKTFTRKKTLVDHQRIHTGEKPYQCSDCGKDFAY
RSAFIVHKKKHAMKRKPEGGPSFSQDTVFQVPQSSHSREEPYKCSQCGKAFRNHSFLLIH
QRVHTGEKPYKCRECGKAFRWSSNLYRHQRIHSLQKQYDCHESEKTPNVEPKILTGEKRF
WCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHSTERPFKCQW
CGKEFIGRHTLSSHQRKHTRAAQAEGSPPARSSSQDTKLRLQKLKPSEEMPLEDCKEACS
QSSRLTGLQDISIGKKCHKCSICGKTFNKSSQLISHKRFHTRERPFKCSKCGKTFRWSSN
LARHMKNHIRD
Download sequence
Identical sequences G1R1Y2
ENSNLEP00000007204 ENSNLEP00000007204 XP_003257000.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]