SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007223 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007223
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 211-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1002
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000362
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007223   Gene: ENSNLEG00000005974   Transcript: ENSNLET00000007581
Sequence length 1029
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:33116827:33131984:1 gene:ENSNLEG00000005974 transcript:ENSNLET00000007581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHSALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHRPGSGEEAVALVEEL
QKDLDGPAIQVPVLVQDQDTLQKAVSAPGTTLPPVLPGSHIAAEICLHPPTDLVAFNLQD
PQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEE
CEWQVLASQWGNETDERADTVKKASLCERDKKKRTPPEKQGQKWKELVDNLTFSSAISES
LIGTEGKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLIDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFSSKSNFIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECQECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEH
KRIHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH
TGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKIHTDEKPCECHVSEKEVSQTSNLHLQQKIHTIGEFSWLQNTN
ESKIEIQKI
Download sequence
Identical sequences G1R201
ENSNLEP00000007223 XP_003256992.1.23891 ENSNLEP00000007223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]