SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007425 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007425
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.52e-60
Family Ankyrin repeat 0.0000487
Further Details:      
 
Domain Number 2 Region: 1025-1189
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-48
Family Phosphotyrosine-binding domain (PTB) 0.0022
Further Details:      
 
Domain Number 3 Region: 807-877
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.96e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 4 Region: 880-943
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.07e-16
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007425   Gene: ENSNLEG00000006082   Transcript: ENSNLET00000007791
Sequence length 1247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:34453685:35785983:-1 gene:ENSNLEG00000006082 transcript:ENSNLET00000007791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGMGRSTVLEEPVQE
DATQETRISSPVESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEEEDDDENTCGPSGLWEALTPCNGCRNLGFP
MLAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLMDTAVTKKPCSLELQGXXXXXTD
NASEVAITTPGTSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHR
MNHNQEYFEINTSTGCTSFTASPPASPPTSSVGTTEVKNEGANHTDDLSRQDGNDPAKEY
DPGQFAGLLHGSSPACESPENPFHLYGKTEQCEKGQDEVSLANSPLPFKQSPIENNSEPL
VKKIKPKVVSRTIFHKKSNQLENHTIVGTRSARSGSRNGDQWVMNTGGFVERACTLGRIR
SLPKALIDMHLSKSVSKSDSDLIAYPSNEKTSRVNWSESSTAEHSSKGNSERTPSFTSEW
EEIDKIMSSIDVGINNELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQ
FMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGD
YTKAFLINGYTSMDLLKKIWEVELINVIKINLIGHRKRILASLGDRLHDDPPQKPPRSIT
LREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQM
AQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTES
TQDACAKMRFFQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPE
DLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTL
PESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF
Download sequence
Identical sequences ENSNLEP00000007425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]