SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007800 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007800
Domain Number 1 Region: 8-186
Classification Level Classification E-value
Superfamily Cyclophilin-like 6.28e-74
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000126
Further Details:      
 
Domain Number 2 Region: 224-368
Classification Level Classification E-value
Superfamily TPR-like 2.46e-28
Family Tetratricopeptide repeat (TPR) 0.00000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007800   Gene: ENSNLEG00000006403   Transcript: ENSNLET00000008174
Sequence length 370
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:24877357:24891361:-1 gene:ENSNLEG00000006403 transcript:ENSNLET00000008174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH
TTGKPLHFRGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDWGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE
MAIKKYAKVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAVDSCLEAL
EIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDK
EKAVYAKMFA
Download sequence
Identical sequences G1R3M8
ENSNLEP00000007800 XP_003257958.1.23891 ENSNLEP00000007800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]