SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007812 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007812
Domain Number 1 Region: 1062-1230
Classification Level Classification E-value
Superfamily Fibronectin type III 3.19e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 2 Region: 2294-2479
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-17
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 3165-3256
Classification Level Classification E-value
Superfamily Fibronectin type III 3.41e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 1989-2072
Classification Level Classification E-value
Superfamily Fibronectin type III 3.48e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 2940-3032
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 1580-1662
Classification Level Classification E-value
Superfamily Fibronectin type III 7.87e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 1368-1458
Classification Level Classification E-value
Superfamily Fibronectin type III 1.64e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 8 Region: 2088-2177
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 9 Region: 3260-3342
Classification Level Classification E-value
Superfamily Fibronectin type III 2.92e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 10 Region: 2620-2710
Classification Level Classification E-value
Superfamily Fibronectin type III 3.48e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 11 Region: 2522-2604
Classification Level Classification E-value
Superfamily Fibronectin type III 6.07e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 12 Region: 2194-2276
Classification Level Classification E-value
Superfamily Fibronectin type III 8.96e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 13 Region: 2835-2924
Classification Level Classification E-value
Superfamily Fibronectin type III 9.08e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 14 Region: 1265-1347
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000146
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 15 Region: 838-926
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000157
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 16 Region: 1672-1758
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000246
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 17 Region: 2727-2811
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000299
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 18 Region: 1773-1861
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000683
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 19 Region: 1884-1966
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000151
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 20 Region: 3056-3140
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000369
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 21 Region: 1479-1567
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000755
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 22 Region: 757-838
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000365
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 23 Region: 959-1039
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000618
Family Fibronectin type III 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007812
Domain Number - Region: 283-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000461
Family Integrin beta EGF-like domains 0.047
Further Details:      
 
Domain Number - Region: 624-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000461
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 594-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000762
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 253-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 315-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 377-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 532-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 191-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 470-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00352
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 408-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00394
Family Integrin beta EGF-like domains 0.074
Further Details:      
 
Domain Number - Region: 439-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00494
Family Integrin beta EGF-like domains 0.059
Further Details:      
 
Domain Number - Region: 501-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 345-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 222-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 563-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 723-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 692-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family Integrin beta EGF-like domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007812   Gene: ENSNLEG00000006421   Transcript: ENSNLET00000008187
Sequence length 3364
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:8707356:8884363:-1 gene:ENSNLEG00000006421 transcript:ENSNLET00000008187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGRTVGAGGGSPSSQLY
EHTVEGGEKQVIFTHRINLPPSTGCGCPPGTEPPVPASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWAGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEDGRCVCDPGYTGEDCGVRSCPRSCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCEDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGPDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGRCED
GVCVCDAGYSGEDCSTRSCPGGCQGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYIGEDCSIRTCPSNCHGRGRCEEGRCLCNPGYTGPTCATRMCPADCWGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPSGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLHVVWTAQPDTFAHFQLRLRVPEGPGAHEEVLPGDIRQALVPPP
PPGTPYELSLRGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKMLPQSDPSPGTPPRLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTANGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELATEAPEPPEEPLLGELTV
TGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGEESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQ
FDSFMVQYKDKDGQPQVMPVAADQREVTVYNLPERKYKMNMYGLHDGQRVGPLSVVIMTA
PLPPAPATEASKPPLEPHLGELTVTDVTPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQVV
PVAADLREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARSDASPGAPPRLGELW
VTDPTPDSLRLSWTVPEGQFNSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFLL
YGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTSVTQNSVGLSWTVPEG
QFDSFVVQYKDRDGQPQVVPVEGSLREVSVPSLEPAHRYKLLLYGLHGGKRVGPISAVAI
TASREEMETETTAPTPPVPEPHLGELTVEEATPHTLHLSWMVPEGEFDSFEIQYTDRDGQ
FQMVRTGGDRNDITLSGLESDHRYLVTLYGFHDGKHVGPVHVEALTVPEEEEPSEPPTAT
PEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGVT
ISGLEPDHKYKMNLYGFHSGQRVGPVSAIGVTAAEEETPSPTEPSTEPPEEPLLGELTVT
GSSPDSLSLSWTVPQGRFDSFTVQYKDRDGKPQVVRVGGEESEVTMGGLEPGRKYKMHLY
GLHEGQRVGPVSAVGVTAPEEESPDVPLVKPRLGEMTVRDVTSDSLSLCWTVPEGQFDHF
LVQYKNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGK
DEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNGDGHS
KATRVPGHEDRVTISGLEPDHKYKMNLYGFHSGQRVGPVSAIGVTAAEEETPSPTEPSTE
APEAPEEPLLGELTVTGSSPDSLSLSWTVPQGHFDSFTVQYKDRDGRPQVVRVGGEENEV
TVGGLEPGHKYKMHLYGLHEGRRVGPVSTVGVTAPREDVDKTPSPTEPGTEAPEPPEEPL
LGLLTVTGSSPDSLSLSWTVPQGHFDSFTVQYKDRDGRPQAVRVGGQESEVTVGGLEPGR
KYKMHLYGLHEGQRLGPVSAVGITEEETPSPTEPSTEAPEPPEEPLLGELTVTGSSPDSL
SLSWTVPQGRFNSFTVQYKDREGQPQVVRVRGEENEVTVGGLEPGRKYKMHLYGLHEGRR
VGPVSTVGVTAPEDEAETTQAVPTTTPEPPIKPRLGELTVTDATPDSLGLSWTVPEGQFD
HFLVQYRNGDGQPKAVRLPGHEDGVTISGLEPDHKYKMNLYGFHSGQRVGPXXXXXXXXE
ETPAPTEPSTEATEPPEEPLLGELTVTGSSPDSLGLSWTVPQGRFDSFTVQYKDRDGRPQ
VVRVGGKEKEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAAEEETPSPTEPSTEA
PEPPEESLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGQPQVVRVGGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTGECGDRPSSPGLPPLPTPPPVEPRLGEL
AVAAVTSDSVGLSWTVAQGLFDSFLVQYRDAQGQPQAVPVSGDLRAVTVSGLDPARKYKF
LLFGLQNGKRHGPVPVEARTGESHSPRTSLSFPAPDTKPSPRLGELTVTDATPDSVGLSW
TVPEGEFDSFVVQHKDKDGRLQVVPVPADQREVTVQGLEPSRKYRFLLYGLLGGKRLGPV
SVLGMTAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQAL
LVDGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGTTRRDTPRSEETLPKAT
PDSV
Download sequence
Identical sequences ENSNLEP00000007812 ENSNLEP00000007812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]