SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007920 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007920
Domain Number 1 Region: 114-173
Classification Level Classification E-value
Superfamily BPTI-like 6.1e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000647
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily BPTI-like 2.98e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.000091
Further Details:      
 
Domain Number 3 Region: 45-101
Classification Level Classification E-value
Superfamily BPTI-like 8.8e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007920   Gene: ENSNLEG00000006511   Transcript: ENSNLET00000008301
Sequence length 300
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:31452161:31537436:-1 gene:ENSNLEG00000006511 transcript:ENSNLET00000008301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKIHALWASICLLLNLAPAPLNADSEEDEEHTIITGTELPPLKLMHSFCAFKADDGPCK
AIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCIRDNANRIMKTTLQQEKPDF
CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNTCEDGPNGFQV
DNYGTQLSAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRP
FKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIEFHHIGASXXXSIVYEEIFVKNM
Download sequence
Identical sequences ENSNLEP00000007920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]