SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007935 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007935
Domain Number 1 Region: 95-290
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-60
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 745-852
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 297-406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-36
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 4 Region: 585-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 406-538
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-33
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 6 Region: 876-969
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 696-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000652
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 541-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000971
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007935   Gene: ENSNLEG00000006519   Transcript: ENSNLET00000008318
Sequence length 980
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:32084008:32207331:1 gene:ENSNLEG00000006519 transcript:ENSNLET00000008318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIR
RIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRA
MFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFG
IVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSI
MHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQES
NGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRK
SPLLGRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSP
NYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKPRDSLILICKPIERHD
NCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFK
EEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPG
WPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFC
GAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYM
CQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIK
LAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDAS
VQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSF
QTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDAVLIHFHTDDTINK
KGFHIRYKTIRYPDTTHTKK
Download sequence
Identical sequences ENSNLEP00000007935 ENSNLEP00000007935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]